Hmdb loader
Identification
HMDB Protein ID HMDBP12026
Secondary Accession Numbers None
Name Palmitoyltransferase ZDHHC2
Synonyms
  1. Reduced expression associated with metastasis protein
  2. Reduced expression in cancer protein
  3. Zinc finger DHHC domain-containing protein 2
  4. Zinc finger protein 372
  5. Ream
  6. Rec
  7. DHHC-2
Gene Name ZDHHC2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Palmitoyltransferase specific for GAP43 and DLG4/PSD95 (By similarity).
Pathways Not Available
Reactions
Palmityl-CoA + protein-cysteine → S-palmitoyl protein + Coenzyme A details
GO Classification
Biological Process
protein palmitoylation
Cellular Component
integral to membrane
Molecular Function
metal ion binding
zinc ion binding
palmitoyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 8
Locus 8p22
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 42021.2
Theoretical pI 8.357
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|7705949|ref|NP_057437.1| palmitoyltransferase ZDHHC2 [Homo sapiens]
MAPSGPGSSARRRCRRVLYWIPVVFITLLLGWSYYAYAIQLCIVSMENTGEQVVCLMAYH
LLFAMFVWSY
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9UIJ5
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:18469
References
General References Not Available