| Identification |
|---|
| HMDB Protein ID
| HMDBP11807 |
| Secondary Accession Numbers
| None |
| Name
| Phosphatidate phosphatase LPIN3 |
| Synonyms
|
- Lipin-3
- Lipin-3-like
|
| Gene Name
| LPIN3 |
| Protein Type
| Unknown |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Regulates fatty acid metabolism. Magnesium-dependent phosphatidate phosphatase enzyme which catalyzes the conversion of phosphatidic acid to diacylglycerol during triglyceride, phosphatidylcholine and phosphatidylethanolamine biosynthesis (By similarity).
|
| Pathways
|
- Glycerolipid metabolism
- Glycerophospholipid metabolism
|
| Reactions
|
| A 1,2-diacylglycerol 3-phosphate + Water → a 1,2-diacyl-sn-glycerol + Phosphate |
details
|
| Phosphatidate + Water → 1,2-Diacyl-sn-glycerol + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| phosphatidylethanolamine biosynthetic process |
| phosphatidylcholine biosynthetic process |
| fatty acid metabolic process |
| Cellular Component |
| endoplasmic reticulum membrane |
| nucleus |
| Molecular Function |
| phosphatidate phosphatase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 20 |
| Locus
| 20q12 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 93613.4 |
| Theoretical pI
| 5.511 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|74271888|ref|NP_075047.1| phosphatidate phosphatase LPIN3 [Homo sapiens]
MNYVGQLAETVFGTVKELYRGLNPATLSGGIDVLVVKQVDGSFRCSPFHVRFGKLGVLRS
REKVVDIELN
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9BQK8 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:14451 |
| References |
|---|
| General References
| Not Available |
