Hmdb loader
Identification
HMDB Protein ID HMDBP11752
Secondary Accession Numbers None
Name N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase, isoform C
Synonyms
  1. N-acetylglucosaminyltransferase
  2. I-branching enzyme
  3. IGNT
Gene Name GCNT2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Branching enzyme that converts linear into branched poly-N-acetyllactosaminoglycans. Introduces the blood group I antigen during embryonic development. It is closely associated with the development and maturation of erythroid cells. The expression of the blood group I antigen in erythrocytes is determined by isoform C.
Pathways
  • Glycosphingolipid biosynthesis - lacto and neolacto series
  • protein glycosylation
Reactions
Uridine diphosphate-N-acetylglucosamine + beta-D-galactosyl-1,4-N-acetyl-D-glucosaminyl-R → Uridine 5'-diphosphate + N-acetyl-beta-D-glucosaminyl-1,6-beta-D-galactosyl-1,4-N-acetyl-D-glucosaminyl-R details
UDP-N-acetyl-D-glucosamine + nLc6Cer → UDP + details
GO Classification
Biological Process
protein glycosylation
Cellular Component
integral to membrane
Golgi membrane
Molecular Function
N-acetyllactosaminide beta-1,6-N-acetylglucosaminyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 6
Locus 6p24.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 45854.405
Theoretical pI 8.215
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|4503963|ref|NP_001482.1| N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase isoform B [Homo sapiens]
MPLSMRYLFIISVSSVIIFIVFSVFNFGGDPSFQRLNISDPLRLTQVCTSFINGKTRFLW
KNKLMIHEKS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8NFS9
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:4204
References
General References Not Available